proteasome (prosome, macropain) subunit, beta type, 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-269	50 μL

Catalog No. 89-004-269 Supplier Abnova Corporation Supplier No. H00005691A01

Description

Mouse polyclonal antibody raised against a partial recombinant PSMB3.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a nonlysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12. [provided by RefSeq

Sequence: EPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD

Specifications

• Antigen: proteasome (prosome, macropain) subunit, beta type, 3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PSMB3.
• Formulation: 50% glycerol
• Gene: PSMB3
• Gene Accession No.: BC013008
• Gene Alias: HC10-II/MGC4147
• Gene Symbols: PSMB3
• Host Species: Mouse
• Immunogen: PSMB3 (AAH13008, 106 a.a. ∼ 205 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Ubiquitin/Proteasome
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5691
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum