proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human PSMD8 protein.

Manufacturer:  Abnova Corporation H00005714B01

Catalog No. 89-006-071

Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a nonlysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1. [provided by RefSeq

Sequence: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Specifications

• Antigen: proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_002812
• Gene Alias: HIP6|HYPF|MGC1660|Nin1p|Rpn12|S14|p31
• Host Species: Mouse
• Quantity: 50 uL
• Research Discipline: Cell Cycle
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: Western Blot
• Description: Mouse polyclonal antibody raised against a full-length human PSMD8 protein.
• Gene: PSMD8
• Format: Serum
• Gene Symbols: PSMD8
• Immunogen: PSMD8 (NP_002803, 1 a.a. ~ 257 a.a) full-length human protein.
• Regulatory Status: RUO
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 5714