proteasome (prosome, macropain) activator subunit 2 (PA28 beta), Mouse, Clone: 1G4, Abnova™

Catalog No.	Quantity
89-014-175	100 μg

Catalog No. 89-014-175 Supplier Abnova Corporation Supplier No. H00005721M02

Description

Mouse monoclonal antibody raised against a partial recombinant PSME2.

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a nonlysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13. [provided by RefSeq

Sequence: MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK

Specifications

• Antigen: proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
• Applications: ELISA, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 1G4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PSME2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PSME2
• Gene Accession No.: NM_002818
• Gene Alias: PA28B/PA28beta/REGbeta
• Gene Symbols: PSME2
• Host Species: Mouse
• Immunogen: PSME2 (NP_002809, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 5721
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ