phosphatase and tensin homolog, Mouse, Clone: 3E7, Abnova™

Catalog No.	Quantity
89-000-917	100 μg

Catalog No. 89-000-917 Supplier Abnova Corporation Supplier No. H00005728M02

Description

Mouse monoclonal antibody raised against a partial recombinant PTEN.

This gene was identified as a tumor suppressor that is mutated in a large number of cancers at high frequency. The protein encoded this gene is a phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase. It contains a tensin like domain as well as a catalytic domain similar to that of the dual specificity protein tyrosine phosphatases. Unlike most of the protein tyrosine phosphatases, this protein preferentially dephosphorylates phosphoinositide substrates. It negatively regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate in cells and functions as a tumor suppressor by negatively regulating AKT/PKB signaling pathway. [provided by RefSeq

Sequence: TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFE

Specifications

• Antigen: phosphatase and tensin homolog
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 3E7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PTEN.
• Formulation: In 1X PBS, pH 7.4
• Gene: PTEN
• Gene Accession No.: NM_000314.1
• Gene Alias: 10q23del/BZS/MGC11227/MHAM/MMAC1/PTEN1/TEP1
• Gene Symbols: PTEN
• Host Species: Mouse
• Immunogen: PTEN (NP_000305.1, 2 a.a. ∼ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5728
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ