pancreas specific transcription factor, 1a, Mouse, Clone: 1A2, Abnova™

Catalog No.	Quantity
89-001-410	100 μg

Catalog No. 89-001-410 Supplier Abnova Corporation Supplier No. H00256297M05

Description

Mouse monoclonal antibody raised against a partial recombinant PTF1A.

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq

Sequence: QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

Specifications

• Antigen: pancreas specific transcription factor, 1a
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1A2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PTF1A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PTF1A
• Gene Accession No.: NM_178161
• Gene Alias: PTF1-p48/bHLHa29
• Gene Symbols: PTF1A
• Host Species: Mouse
• Immunogen: PTF1A (NP_835455, 250 a.a. ∼ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 256297
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a