Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000918

parathyroid hormone, Mouse, Clone: 2A6, Abnova™

Catalog No. 89000918 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-918 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-918 Supplier Abnova Corporation Supplier No. H00005741M12
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant PTH.

The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). [provided by RefSeq]

Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Specifications

Antigen parathyroid hormone
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2A6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant PTH.
Formulation PBS with no preservative; pH 7.4
Gene PTH
Gene Accession No. N/A
Gene Alias PTH1
Gene Symbols PTH
Host Species Mouse
Immunogen PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 5741
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.