PTK2 (M03), Mouse anti-Human, Clone: 1D7, Abnova™

Catalog No.	Quantity
89-123-279	50 μg

Catalog No. 89-123-279 Supplier Abnova Corporation Supplier No. H00005747M03

Description

Mouse monoclonal antibody raised against a partial recombinant PTK2.

This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. At least four transcript variants encoding four different isoforms have been found for this gene, but the full-length natures of only two of them have been determined. [provided by RefSeq

Sequence: EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ

Specifications

• Antigen: PTK2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PTK2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PTK2
• Gene Accession No.: BC028733
• Gene Alias: FADK/FAK/FAK1/pp125FAK
• Gene Symbols: PTK2
• Host Species: Mouse
• Immunogen: PTK2 (AAH28733, 355 a.a. ∼ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5747
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ