Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014354

polymerase I and transcript release factor, Mouse, Clone: 1F7, Abnova™

Catalog No. 89014354 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-354 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-354 Supplier Abnova Corporation Supplier No. H00284119M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PTRF.

Sequence: KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPF

Specifications

Antigen polymerase I and transcript release factor
Applications ELISA, Immunohistochemistry (PFA fixed)
Classification Monoclonal
Clone 1F7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PTRF.
Formulation PBS with no preservative; pH 7.4
Gene PTRF
Gene Accession No. NM_012232
Gene Alias FKSG13
Gene Symbols PTRF
Host Species Mouse
Immunogen PTRF (NP_036364, 233 a.a. ∼ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 284119
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.