pentraxin-related gene, rapidly induced by IL-1 beta, Mouse, Clone: 5B7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PTX3.

Supplier:  Abnova Corporation H00005806M01

Catalog No. 89-000-923

Description

Sequence: SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV

Specifications

• Antigen: pentraxin-related gene, rapidly induced by IL-1 beta
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002852
• Gene Symbols: PTX3
• Immunogen: PTX3 (NP_002843, 282 a.a. ∼ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 5806
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 5B7
• Description: Mouse monoclonal antibody raised against a partial recombinant PTX3.
• Gene: PTX3
• Gene Alias: TNFAIP5/TSG-14
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody