Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000923

pentraxin-related gene, rapidly induced by IL-1 beta, Mouse, Clone: 5B7, Abnova™

Catalog No. 89000923 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-923 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-923 Supplier Abnova Corporation Supplier No. H00005806M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PTX3.

Sequence: SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV

Specifications

Antigen pentraxin-related gene, rapidly induced by IL-1 beta
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5B7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PTX3.
Formulation PBS with no preservative; pH 7.4
Gene PTX3
Gene Accession No. NM_002852
Gene Alias TNFAIP5/TSG-14
Gene Symbols PTX3
Host Species Mouse
Immunogen PTX3 (NP_002843, 282 a.a. ∼ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 5806
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.