purine-rich element binding protein A, Mouse, Clone: 1D6, Abnova™

Catalog No.	Quantity
89-000-925	100 μg

Catalog No. 89-000-925 Supplier Abnova Corporation Supplier No. H00005813M07

Description

Mouse monoclonal antibody raised against a partial recombinant PURA.

This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia. [provided by RefSeq

Sequence: TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC

Specifications

• Antigen: purine-rich element binding protein A
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1D6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PURA.
• Formulation: PBS with no preservative; pH 7.4
• Gene: PURA
• Gene Accession No.: NM_005859
• Gene Alias: PUR-ALPHA/PUR1/PURALPHA
• Gene Symbols: PURA
• Host Species: Mouse
• Immunogen: PURA (NP_005850, 183 a.a. ∼ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5813
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ