purine-rich element binding protein A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-273	50 μL

Catalog No. 89-004-273 Supplier Abnova Corporation Supplier No. H00005813A01

Description

Mouse polyclonal antibody raised against a partial recombinant PURA.

This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia. [provided by RefSeq

Sequence: TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC

Specifications

• Antigen: purine-rich element binding protein A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PURA.
• Formulation: 50% glycerol
• Gene: PURA
• Gene Accession No.: NM_005859
• Gene Alias: PUR-ALPHA/PUR1/PURALPHA
• Gene Symbols: PURA
• Host Species: Mouse
• Immunogen: PURA (NP_005850, 183 a.a. ∼ 292 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5813
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum