Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001556

poliovirus receptor-related 4, Mouse, Clone: 1D7, Abnova™

Catalog No. 89001556 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-556 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-556 Supplier Abnova Corporation Supplier No. H00081607M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PVRL4.

Poliovirus receptor-like proteins (PVRLs), such as PVRL4, are adhesion receptors of the immunoglobulin superfamily and function in cell-cell adhesion (Reymond et al., 2001 [PubMed 11544254]).[supplied by OMIM

Sequence: AGELGTSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQA

Specifications

Antigen poliovirus receptor-related 4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1D7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PVRL4.
Formulation ascites with no preservative
Gene PVRL4
Gene Accession No. NM_030916
Gene Alias LNIR/PRR4/nectin-4
Gene Symbols PVRL4
Host Species Mouse
Immunogen PVRL4 (NP_112178, 31 a.a. ∼ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 81607
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.