Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89007978

RAB22A, member RAS oncogene family, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89007978 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-007-978 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-007-978 Supplier Abnova Corporation Supplier No. H00057403B01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a full-length human RAB22A protein.

The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq

Sequence: MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRRHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

Specifications

Antigen RAB22A, member RAS oncogene family
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human RAB22A protein.
Formulation No additive
Gene RAB22A
Gene Accession No. BC015710
Gene Alias MGC16770
Gene Symbols RAB22A
Host Species Mouse
Immunogen RAB22A (AAH15710.1, 1 a.a. ∼ 194 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 57403
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.