RAB22A, member RAS oncogene family, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RAB22A protein.

Supplier:  Abnova Corporation H00057403B01

Catalog No. 89-007-978

Description

The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq

Sequence: MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRRHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

Specifications

• Antigen: RAB22A, member RAS oncogene family
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human RAB22A protein.
• Gene: RAB22A
• Gene Alias: MGC16770
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC015710
• Gene Symbols: RAB22A
• Immunogen: RAB22A (AAH15710.1, 1 a.a. ∼ 194 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 57403
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.