Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001199

RAB31, member RAS oncogene family, Mouse, Clone: 4D12, Abnova™

Catalog No. 89001199 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-199 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-199 Supplier Abnova Corporation Supplier No. H00011031M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RAB31.

Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting (Bao et al., 2002 [PubMed 11784320]).[supplied by OMIM

Sequence: TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

Specifications

Antigen RAB31, member RAS oncogene family
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4D12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RAB31.
Formulation PBS with no preservative; pH 7.4
Gene RAB31
Gene Accession No. BC001148
Gene Alias Rab22B
Gene Symbols RAB31
Host Species Mouse
Immunogen RAB31 (AAH01148, 96 a.a. ∼ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 11031
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.