Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB33B, member RAS oncogene family (A01), Mouse anti-Human, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RAB33B.

Manufacturer:  Abnova Corporation H00083452A01

Catalog No. 89-004-733


Add to cart

Description

Description

Sequence: TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
Specifications

Specifications

RAB33B, member RAS oncogene family
Unconjugated
50% glycerol
NM_031296
DKFZp434G099|MGC138182
Mouse
50 uL
Signal Transduction
Y
Polyclonal
Human, Murine
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant RAB33B.
RAB33B
Serum
RAB33B
RAB33B (NP_112586, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
83452
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit