RAB, member of RAS oncogene family-like 2B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RABL2B protein.

Supplier:  Abnova Corporation H00011158B01

Catalog No. 89-007-144

Description

The RABL2B protein is a member of the RAB gene family which belongs to the RAS GTPase superfamily. RABL2B is located within a subtelomeric region of 22q13.3. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq

Sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS

Specifications

• Antigen: RAB, member of RAS oncogene family-like 2B
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human RABL2B protein.
• Gene: RABL2B
• Gene Alias: FLJ93981/FLJ98216
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_001003789
• Gene Symbols: RABL2B
• Immunogen: RABL2B (NP_001003789, 1 a.a. ∼ 229 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 11158
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.