ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2), Mouse, Clone: 3B10-2D9, Abnova™

Catalog No.	Quantity
89-001-483	200 μL

Catalog No. 89-001-483 Supplier Abnova Corporation Supplier No. H00005880M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant RAC2.

The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. [provided by RefSeq

Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL

Specifications

• Antigen: ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3B10-2D9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant RAC2.
• Formulation: ascites with no preservative
• Gene: RAC2
• Gene Accession No.: BC001485
• Gene Alias: EN-7/Gx/HSPC022
• Gene Symbols: RAC2
• Host Species: Mouse
• Immunogen: RAC2 (AAH01485.1, 1 a.a. ∼ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5880
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ