Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAC2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant RAC2.

Manufacturer:  Abnova Corporation H00005880A01

Catalog No. 89-003-064


Add to cart

Description

Description

The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. [provided by RefSeq

Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Specifications

Specifications

RAC2
Unconjugated
50% glycerol
BC001485
EN-7|Gx|HSPC022
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA
Mouse polyclonal antibody raised against a full-length recombinant RAC2.
RAC2
Liquid
RAC2
RAC2 (AAH01485.1, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag.
RUO
Primary
5880
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit