RAD18 homolog (S. cerevisiae), Mouse, Clone: 3H7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RAD18.

Supplier:  Abnova Corporation H00056852M01

Catalog No. 89-014-321

Description

The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq

Sequence: EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV

Specifications

• Antigen: RAD18 homolog (S. cerevisiae)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020165
• Gene Symbols: RAD18
• Immunogen: RAD18 (NP_064550, 332 a.a. ∼ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
• Clone: 3H7
• Description: Mouse monoclonal antibody raised against a partial recombinant RAD18.
• Gene: RAD18
• Gene Alias: RNF73
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56852
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ