v-raf-1 murine leukemia viral oncogene homolog 1, Mouse, Clone: 1H4, Abnova™

Catalog No.	Quantity
89-000-929	100 μg

Catalog No. 89-000-929 Supplier Abnova Corporation Supplier No. H00005894M03

Description

Mouse monoclonal antibody raised against a partial recombinant RAF1.

This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. [provided by RefSeq

Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDF

Specifications

• Antigen: v-raf-1 murine leukemia viral oncogene homolog 1
• Applications: ELISA, In situ PLA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 1H4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RAF1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RAF1
• Gene Accession No.: BC018119
• Gene Alias: CRAF/NS5/Raf-1/c-Raf
• Gene Symbols: RAF1
• Host Species: Mouse
• Immunogen: RAF1 (AAH18119, 1 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5894
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ