RAG1AP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192311

Catalog No. NBP192311

Description

RAG1AP1 Polyclonal specifically detects RAG1AP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RAG1AP1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: HsSWEET1RAG1-activating protein 1, probable sugar transporter RAG1AP1, RAG1AP1SWEET1, recombination activating gene 1 activating protein 1, RZPDo834D038D, SCPRP11-540D14.5, slv, solute carrier family 50 (sugar transporter), member 1, Solute carrier family 50 member 1, Stromal cell protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55974
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC50A1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only