Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
anti-RAG1AP1, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals
NBP192311
Description
RAG1AP1 Polyclonal antibody specifically detects RAG1AP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RAG1AP1 | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HsSWEET1RAG1-activating protein 1, probable sugar transporter RAG1AP1, RAG1AP1SWEET1, recombination activating gene 1 activating protein 1, RZPDo834D038D, SCPRP11-540D14.5, slv, solute carrier family 50 (sugar transporter), member 1, Solute carrier family 50 member 1, Stromal cell protein | |
| Rabbit | |
| IgG | |
| 0.1 ml | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| Polyclonal | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Affinity Purified | |
| SLC50A1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDG | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| 55974 | |
| Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only