retinoic acid receptor, alpha, Mouse, Clone: 2D2, Abnova™

Catalog No.	Quantity
89-000-932	100 μg

Catalog No. 89-000-932 Supplier Abnova Corporation Supplier No. H00005914M03

Description

Mouse monoclonal antibody raised against a partial recombinant RARA.

Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor (RXR; see MIM 180245), which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1 (MIM 600849), SMRT (NCOR2; MIM 600848), and histone deacetylase (see MIM 601241). When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases (see MIM 603053), and the basic transcription machinery. Translocations that always involve rearrangement of the RARA gene are a cardinal feature of acute promyelocytic leukemia (APL; MIM 612376). The most frequent translocation is t(15,17)(q21;q22), which fuses the RARA gene with the PML gene (MIM 102578) (Vitoux et al., 2007 [PubMed 17468032]).[supplied by OMIM

Sequence: QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS

Specifications

• Antigen: retinoic acid receptor, alpha
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2D2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RARA.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RARA
• Gene Accession No.: NM_000964
• Gene Alias: NR1B1/RAR
• Gene Symbols: RARA
• Host Species: Mouse
• Immunogen: RARA (NP_000955, 315 a.a. ∼ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5914
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ