RASA1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-065	50 μL

Catalog No. 89-003-065 Supplier Abnova Corporation Supplier No. H00005921A01

Description

Mouse polyclonal antibody raised against a partial recombinant RASA1.

The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues. [provided by RefSeq

Sequence: AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR

Specifications

• Antigen: RASA1
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RASA1.
• Formulation: 50% glycerol
• Gene: RASA1
• Gene Accession No.: NM_002890
• Gene Alias: CM-AVM/CMAVM/DKFZp434N071/GAP/PKWS/RASA/RASGAP/p120GAP/p120RASGAP
• Gene Symbols: RASA1
• Host Species: Mouse
• Immunogen: RASA1 (NP_002881, 948 a.a. ∼ 1047 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5921
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid