Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001216

RAS p21 protein activator 3, Mouse, Clone: 1F11, Abnova™

Catalog No. 89001216 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-216 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-216 Supplier Abnova Corporation Supplier No. H00022821M01J
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RASA3.

The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This family member is an inositol 1,3,4,5-tetrakisphosphate-binding protein, like the closely related RAS p21 protein activator 2. The two family members have distinct pleckstrin-homology domains, with this particular member having a domain consistent with its localization to the plasma membrane. [provided by RefSeq

Sequence: DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI

Specifications

Antigen RAS p21 protein activator 3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1F11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RASA3.
Formulation PBS with no preservative; pH 7.4
Gene RASA3
Gene Accession No. BC047242
Gene Alias GAP1IP4BP/GAPIII/MGC46517/MGC47588
Gene Symbols RASA3
Host Species Mouse
Immunogen RASA3 (AAH47242, 725 a.a. ∼ 834 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 22821
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.