RAS guanyl releasing protein 2 (calcium and DAG-regulated), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-480	50 μL

Catalog No. 89-004-480 Supplier Abnova Corporation Supplier No. H00010235A01

Description

Mouse polyclonal antibody raised against a partial recombinant RASGRP2.

The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Three alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: GTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKE

Specifications

• Antigen: RAS guanyl releasing protein 2 (calcium and DAG-regulated)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RASGRP2.
• Formulation: 50% glycerol
• Gene: RASGRP2
• Gene Accession No.: NM_005825
• Gene Alias: CALDAG-GEFI/CDC25L
• Gene Symbols: RASGRP2
• Host Species: Mouse
• Immunogen: RASGRP2 (NP_005816, 65 a.a. ∼ 164 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10235
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum