RAS guanyl releasing protein 3 (calcium and DAG-regulated), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-572	50 μL

Catalog No. 89-004-572 Supplier Abnova Corporation Supplier No. H00025780A01

Description

Mouse polyclonal antibody raised against a partial recombinant RASGRP3.

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RASGRP3, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM

Sequence: AGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG

Specifications

• Antigen: RAS guanyl releasing protein 3 (calcium and DAG-regulated)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RASGRP3.
• Formulation: 50% glycerol
• Gene: RASGRP3
• Gene Accession No.: BC027849
• Gene Alias: GRP3/KIAA0846
• Gene Symbols: RASGRP3
• Host Species: Mouse
• Immunogen: RASGRP3 (AAH27849, 581 a.a. ∼ 690 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 25780
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum