RAS guanyl releasing protein 4, Mouse, Clone: 6D3, Abnova™

Catalog No.	Quantity
89-001-386	100 μg

Catalog No. 89-001-386 Supplier Abnova Corporation Supplier No. H00115727M02

Description

Mouse monoclonal antibody raised against a partial recombinant RASGRP4.

The protein encoded by this gene is a member of the Ras guanyl nucleotide-releasing protein (RasGRP) family of Ras guanine nucleotide exchange factors. It contains a Ras exchange motif, a diacylglycerol-binding domain, and two calcium-binding EF hands. This protein was shown to activate H-Ras in a cation-dependent manner in vitro. Expression of this protein in myeloid cell lines was found to be correlated with elevated level of activated RAS protein, and the RAS activation can be greatly enhanced by phorbol ester treatment, which suggested a role of this protein in diacylglycerol regulated cell signaling pathways. Studies of a mast cell leukemia cell line expressing substantial amounts of abnormal transcripts of this gene indicated that this gene may play an important role in the final stages of mast cell development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: CGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS

Specifications

• Antigen: RAS guanyl releasing protein 4
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 6D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RASGRP4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RASGRP4
• Gene Accession No.: NM_170603
• Gene Symbols: RASGRP4
• Host Species: Mouse
• Immunogen: RASGRP4 (NP_733748, 574 a.a. ∼ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 115727
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ