retinoblastoma binding protein 4, Mouse, Clone: 4A5, Abnova™

Catalog No.	Quantity
89-000-933	100 μg

Catalog No. 89-000-933 Supplier Abnova Corporation Supplier No. H00005928M02

Description

Mouse monoclonal antibody raised against a partial recombinant RBBP4.

This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: HKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS*

Specifications

• Antigen: retinoblastoma binding protein 4
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 4A5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RBBP4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RBBP4
• Gene Accession No.: NM_005610
• Gene Alias: NURF55/RBAP48
• Gene Symbols: RBBP4
• Host Species: Mouse
• Immunogen: RBBP4 (NP_005601, 316 a.a. ∼ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5928
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ