Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNA binding motif protein 9, Mouse, Clone: 4G3, Abnova™

Catalog No. 89014289 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-289 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-289 Supplier Abnova Corporation Supplier No. H00023543M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant RBM9.

This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS

Specifications

Antigen RNA binding motif protein 9
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
Classification Monoclonal
Clone 4G3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RBM9.
Formulation PBS with no preservative; pH 7.4
Gene RBM9
Gene Accession No. BC013115
Gene Alias FOX2/Fox-2/HNRBP2/HRNBP2/RTA/dJ106I20.3/fxh
Gene Symbols RBM9
Host Species Mouse
Immunogen RBM9 (AAH13115, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Primary or Secondary Primary
Gene ID (Entrez) 23543
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.