RNA binding motif protein 9, Mouse, Clone: 5E11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RBM9.

Supplier:  Abnova Corporation H00023543M02

Catalog No. 89-001-231

Description

This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS

Specifications

• Antigen: RNA binding motif protein 9
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC013115
• Gene Symbols: RBM9
• Immunogen: RBM9 (AAH13115, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 5E11
• Description: Mouse monoclonal antibody raised against a partial recombinant RBM9.
• Gene: RBM9
• Gene Alias: FOX2/Fox-2/HNRBP2/HRNBP2/RTA/dJ106I20.3/fxh
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 23543
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ