retinol binding protein 4, plasma, Mouse, Clone: 4H7, Abnova™

Catalog No.	Quantity
89-000-936	100 μg

Catalog No. 89-000-936 Supplier Abnova Corporation Supplier No. H00005950M02

Description

Mouse monoclonal antibody raised against a full-length recombinant RBP4.

This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. [provided by RefSeq

Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Specifications

• Antigen: retinol binding protein 4, plasma
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4H7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant RBP4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RBP4
• Gene Accession No.: BC020633
• Gene Symbols: RBP4
• Host Species: Mouse
• Immunogen: RBP4 (AAH20633.1, 19 a.a. ∼ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5950
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 λ