RCBTB2, Mouse, Clone: 4G12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RCBTB2.

Manufacturer: Abnova Corporation H00001102M06A

Catalog No. 89-021-068

  N/A
Add to Cart
  Our pricing system is currently unavailable. You are viewing list price.
You can save item(s) to your list now to purchase when our pricing system is available.

    Specifications

    Format Ascites
    Formulation In ascites fluid
    Gene RCBTB2
    Gene Accession No. NM_001268
    Gene Alias CHC1L
    Gene Symbols RCBTB2
    Applications Enzyme Linked Immunosorbent Assay
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Gene ID (Entrez) 1102
    Description regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
    Antigen RCBTB2
    Host Species Mouse
    Immunogen RCBTB2 (NP_001259, 86 a.a. ∽195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG2a, κ
    Quantity 200μL
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Clone 4G12
    Conjugate Unlabeled
    Cross Reactivity Human

    This gene encodes a member of the RCC1-related GEF family. The N-terminal half of the encoded amino acid sequence shows similarity to the regulator of chromosome condensation RCC1, which acts as a guanine nucleotide exchange factor (GEF) protein for the Ras-related GTPase Ran. [provided by RefSeq

    Sequence: TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit