Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RCBTB2.

Manufacturer:  Abnova Corporation H00001102A01

Catalog No. 89-004-064


Add to cart

Description

Description

This gene encodes a member of the RCC1-related GEF family. The N-terminal half of the encoded amino acid sequence shows similarity to the regulator of chromosome condensation RCC1, which acts as a guanine nucleotide exchange factor (GEF) protein for the Ras-related GTPase Ran. [provided by RefSeq

Sequence: TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI
Specifications

Specifications

regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
Unconjugated
50% glycerol
NM_001268
CHC1L
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1102
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant RCBTB2.
RCBTB2
Serum
RCBTB2
RCBTB2 (NP_001259, 86 a.a. ~ 194 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit