retinol dehydrogenase 11 (all-trans/9-cis/11-cis), Mouse, Clone: 1H6, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant RDH11.

Supplier:  Abnova Corporation H00051109M01

Catalog No. 89-014-310

Description

RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.[supplied by OMIM

Sequence: IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID

Specifications

• Antigen: retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC000112
• Gene Symbols: RDH11
• Immunogen: RDH11 (AAH00112, 24 a.a. ∼ 318 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 1H6
• Description: Mouse monoclonal antibody raised against a full length recombinant RDH11.
• Gene: RDH11
• Gene Alias: ARSDR1/CGI-82/FLJ32633/HCBP12/MDT1/PSDR1/RALR1/SCALD/SDR7C1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51109
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 λ