Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

retinol dehydrogenase 11 (all-trans/9-cis/11-cis), Mouse, Clone: 1H6, Abnova™

Catalog No. 89014310 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-310 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-310 Supplier Abnova Corporation Supplier No. H00051109M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant RDH11.

RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.[supplied by OMIM

Sequence: IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID

Specifications

Antigen retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1H6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant RDH11.
Formulation PBS with no preservative; pH 7.4
Gene RDH11
Gene Accession No. BC000112
Gene Alias ARSDR1/CGI-82/FLJ32633/HCBP12/MDT1/PSDR1/RALR1/SCALD/SDR7C1
Gene Symbols RDH11
Host Species Mouse
Immunogen RDH11 (AAH00112, 24 a.a. ∼ 318 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51109
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.