regenerating islet-derived 1 alpha, Mouse, Clone: 4F1, Abnova™

Catalog No.	Quantity
89-000-939	100 μg

Catalog No. 89-000-939 Supplier Abnova Corporation Supplier No. H00005967M16

Description

Mouse monoclonal antibody raised against a partial recombinant REG1A.

This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq

Sequence: MNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN

Specifications

• Antigen: regenerating islet-derived 1 alpha
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4F1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant REG1A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: REG1A
• Gene Accession No.: BC005350
• Gene Alias: ICRF/MGC12447/P19/PSP/PSPS/PSPS1/PTP/REG
• Gene Symbols: REG1A
• Host Species: Mouse
• Immunogen: REG1A (AAH05350, 67 a.a. ∼ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5967
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ