Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001257

RAS (RAD and GEM)-like GTP-binding 1, Mouse, Clone: 3A9, Abnova™

Catalog No. 89001257 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-257 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-257 Supplier Abnova Corporation Supplier No. H00028954M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant REM1.

The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells. [provided by RefSeq

Sequence: SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSA

Specifications

Antigen RAS (RAD and GEM)-like GTP-binding 1
Applications ELISA
Classification Monoclonal
Clone 3A9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant REM1.
Formulation PBS with no preservative; pH 7.4
Gene REM1
Gene Accession No. NM_014012
Gene Alias GD:REM/GES/MGC48669/REM
Gene Symbols REM1
Host Species Mouse
Immunogen REM1 (NP_054731, 162 a.a. ∼ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 28954
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.