RAS (RAD and GEM)-like GTP-binding 1, Mouse, Clone: 3A9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant REM1.

Supplier:  Abnova Corporation H00028954M02

Catalog No. 89-001-257

Description

The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells. [provided by RefSeq

Sequence: SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSA

Specifications

• Antigen: RAS (RAD and GEM)-like GTP-binding 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_014012
• Gene Symbols: REM1
• Immunogen: REM1 (NP_054731, 162 a.a. ∼ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA
• Clone: 3A9
• Description: Mouse monoclonal antibody raised against a partial recombinant REM1.
• Gene: REM1
• Gene Alias: GD:REM/GES/MGC48669/REM
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 28954
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ