renin binding protein, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-280	50 μL

Catalog No. 89-004-280 Supplier Abnova Corporation Supplier No. H00005973A01

Description

Mouse polyclonal antibody raised against a partial recombinant RENBP.

The gene product inhibits renin activity by forming a dimer with renin, a complex known as high molecular weight renin. The encoded protein contains a leucine zipper domain, which is essential for its dimerization with renin. The gene product can catalyze the interconversion of N-acetylglucosamine to N-acetylmannosamine, indicating that it is a GlcNAc 2-epimerase. Transcript variants utilizing alternative promoters have been described in the literature. [provided by RefSeq

Sequence: FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR

Specifications

• Antigen: renin binding protein
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RENBP.
• Formulation: 50% glycerol
• Gene: RENBP
• Gene Accession No.: NM_002910
• Gene Alias: RBP/RNBP
• Gene Symbols: RENBP
• Host Species: Mouse
• Immunogen: RENBP (NP_002901, 301 a.a. ∼ 400 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5973
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum