ret proto-oncogene, Mouse, Clone: 1C6, Abnova™

Catalog No.	Quantity
89-000-940	100 μg

Catalog No. 89-000-940 Supplier Abnova Corporation Supplier No. H00005979M07

Description

Mouse monoclonal antibody raised against a partial recombinant RET.

This gene, a member of the cadherin superfamily, encodes one of the receptor tyrosine kinases, which are cell-surface molecules that transduce signals for cell growth and differentiation. This gene plays a crucial role in neural crest development, and it can undergo oncogenic activation in vivo and in vitro by cytogenetic rearrangement. Mutations in this gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their biological validity has not been confirmed. [provided by RefSeq

Sequence: NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVENCLADLTGDAVSGRDEARSSGLGSQKHPGS

Specifications

• Antigen: ret proto-oncogene
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1C6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RET.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RET
• Gene Accession No.: BC003072
• Gene Alias: CDHF12/HSCR1/MEN2A/MEN2B/MTC1/PTC/RET-ELE1/RET51
• Gene Symbols: RET
• Host Species: Mouse
• Immunogen: RET (AAH03072, 361 a.a. ∼ 458 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5979
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ