replication factor C (activator 1) 2, 40kDa, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-281	50 μL

Catalog No. 89-004-281 Supplier Abnova Corporation Supplier No. H00005982A01

Description

Mouse polyclonal antibody raised against a partial recombinant RFC2.

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also called activator 1, is a protein complex consisting of five distinct subunits of 145, 40, 38, 37, and 36.5kDa. This gene encodes the 40kDa subunit, which has been shown to be responsible for binding ATP. Deletion of this gene has been associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Sequence: FINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVA

Specifications

• Antigen: replication factor C (activator 1) 2, 40kDa
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RFC2.
• Formulation: 50% glycerol
• Gene: RFC2
• Gene Accession No.: NM_181471
• Gene Alias: A1/MGC3665/RFC40
• Gene Symbols: RFC2
• Host Species: Mouse
• Immunogen: RFC2 (NP_852136, 245 a.a. ∼ 353 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5982
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum