Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RGS3, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RGS3 protein.

Manufacturer:  Abnova Corporation H00005998B01P

Catalog No. 89-002-590


Add to cart

Description

Description

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. [provided by RefSeq

Sequence: MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Specifications

Specifications

RGS3
Unconjugated
In 1X PBS, pH 7.4
NM_134427
C2PA|FLJ20370|FLJ31516|FLJ90496|PDZ-RGS3|RGP3
Mouse
50 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human RGS3 protein.
RGS3
Purified
RGS3
RGS3 (NP_602299.1, 1 a.a. ~ 168 a.a) full-length human protein.
RUO
Primary
5998
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit