RGS3, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-002-590	50 μg

Catalog No. 89-002-590 Supplier Abnova Corporation Supplier No. H00005998B01P

Description

Mouse polyclonal antibody raised against a full-length human RGS3 protein.

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. [provided by RefSeq

Sequence: MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Specifications

• Antigen: RGS3
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human RGS3 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RGS3
• Gene Accession No.: NM_134427
• Gene Alias: C2PA/FLJ20370/FLJ31516/FLJ90496/PDZ-RGS3/RGP3
• Gene Symbols: RGS3
• Host Species: Mouse
• Immunogen: RGS3 (NP_602299.1, 1 a.a. ∼ 168 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5998
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG