Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RHOG, Mouse, Clone: 2E6, Abnova™

Catalog No. 89016206 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-206 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-206 Supplier Abnova Corporation Supplier No. H00000391M05
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant RHOG.

ARHG is a member of the RAS superfamily of genes, which encode GTP-binding proteins that act in the pathway of signal transduction and play a key role in the regulation of cellular functions.[supplied by OMIM

Sequence: RHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL

Specifications

Antigen RHOG
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2E6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RHOG.
Formulation PBS with no preservative; pH 7.4
Gene RHOG
Gene Accession No. NM_001665
Gene Alias ARHG/MGC125835/MGC125836
Gene Symbols RHOG
Host Species Mouse
Immunogen RHOG (NP_001656, 94 a.a. ∼ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 391
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.