Ras and Rab interactor 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-647	50 μL

Catalog No. 89-004-647 Supplier Abnova Corporation Supplier No. H00054453A01

Description

Mouse polyclonal antibody raised against a partial recombinant RIN2.

The RAB5 protein is a small GTPase involved in membrane trafficking in the early endocytic pathway. The protein encoded by this gene binds the GTP-bound form of the RAB5 protein preferentially over the GDP-bound form, and functions as a guanine nucleotide exchange factor for RAB5. The encoded protein is found primarily as a tetramer in the cytoplasm and does not bind other members of the RAB family. [provided by RefSeq

Sequence: DFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTT

Specifications

• Antigen: Ras and Rab interactor 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RIN2.
• Formulation: 50% glycerol
• Gene: RIN2
• Gene Accession No.: NM_018993
• Gene Alias: RASSF4
• Gene Symbols: RIN2
• Host Species: Mouse
• Immunogen: RIN2 (NP_061866, 786 a.a. ∼ 894 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 54453
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum