RIO kinase 3 (yeast), Mouse, Clone: 3G11, Abnova™

Catalog No.	Quantity
89-001-100	100 μg

Catalog No. 89-001-100 Supplier Abnova Corporation Supplier No. H00008780M02

Description

Mouse monoclonal antibody raised against a partial recombinant RIOK3.

This gene was identified by the similarity of its product to the Aspergillus nidulans SUDD protein, an extragenic suppressor of the heat-sensitive bimD6 mutation that fails to attach properly to the spindle microtubules at a restrictive temperature. The specific function of this gene has not yet been determined. [provided by RefSeq

Sequence: NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE

Specifications

• Antigen: RIO kinase 3 (yeast)
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 3G11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RIOK3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RIOK3
• Gene Accession No.: BC039729
• Gene Alias: DKFZp779L1370/SUDD
• Gene Symbols: RIOK3
• Host Species: Mouse
• Immunogen: RIOK3 (AAH39729, 411 a.a. ∼ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8780
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ