receptor-interacting serine-threonine kinase 2, Mouse, Clone: 7F5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RIPK2.

Supplier:  Abnova Corporation H00008767M05

Catalog No. 89-001-099

Description

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq

Sequence: LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

Specifications

• Antigen: receptor-interacting serine-threonine kinase 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC004553
• Gene Symbols: RIPK2
• Immunogen: RIPK2 (AAH04553, 431 a.a. ∼ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 7F5
• Description: Mouse monoclonal antibody raised against a partial recombinant RIPK2.
• Gene: RIPK2
• Gene Alias: CARD3/CARDIAK/CCK/GIG30/RICK/RIP2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 8767
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ