Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001295

receptor-interacting serine-threonine kinase 4, Mouse, Clone: 1G2, Abnova™

Catalog No. 89001295 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-295 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-295 Supplier Abnova Corporation Supplier No. H00054101M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RIPK4.

The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq

Sequence: HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT

Specifications

Antigen receptor-interacting serine-threonine kinase 4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1G2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RIPK4.
Formulation PBS with no preservative; pH 7.4
Gene RIPK4
Gene Accession No. NM_020639
Gene Alias ANKK2/ANKRD3/DIK/MGC129992/MGC129993/PKK/RIP4
Gene Symbols RIPK4
Host Species Mouse
Immunogen RIPK4 (NP_065690, 675 a.a. ∼ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 54101
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.