Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RND1, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RND1 protein.

Manufacturer:  Abnova Corporation H00027289B01P

Catalog No. 89-002-841


Add to cart

Description

Description

Members of the Rho GTPase family, such as RND1, regulate the organization of the actin cytoskeleton in response to extracellular growth factors (Nobes et al., 1998 [PubMed 9531558]).[supplied by OMIM

Sequence: MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Specifications

Specifications

RND1
Unconjugated
In 1X PBS, pH 7.4
NM_014470
ARHS|FLJ42294|RHO6|RHOS
Mouse
50 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human RND1 protein.
RND1
Purified
RND1
RND1 (NP_055285, 1 a.a. ~ 232 a.a) full-length human protein.
RUO
Primary
27289
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit