Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Rho family GTPase 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004598 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-598 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-598 Supplier Abnova Corporation Supplier No. H00027289A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant RND1.

Members of the Rho GTPase family, such as RND1, regulate the organization of the actin cytoskeleton in response to extracellular growth factors (Nobes et al., 1998 [PubMed 9531558]).[supplied by OMIM

Sequence: LSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM

Specifications

Antigen Rho family GTPase 1
Applications ELISA
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant RND1.
Formulation 50% glycerol
Gene RND1
Gene Accession No. NM_014470
Gene Alias ARHS/FLJ42294/RHO6/RHOS
Gene Symbols RND1
Host Species Mouse
Immunogen RND1 (NP_055285, 133 a.a. ∼ 232 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Cell Adhesion
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 27289
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.