ring finger protein 12, Mouse, Clone: 1G10, Abnova™

Catalog No.	Quantity
89-014-311	100 μg

Catalog No. 89-014-311 Supplier Abnova Corporation Supplier No. H00051132M01

Description

Mouse monoclonal antibody raised against a partial recombinant RNF12.

The protein encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be an E3 ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq

Sequence: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN

Specifications

• Antigen: ring finger protein 12
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 1G10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant RNF12.
• Formulation: PBS with no preservative; pH 7.4
• Gene: RNF12
• Gene Accession No.: NM_016120
• Gene Alias: MGC15161/NY-REN-43/RLIM
• Gene Symbols: RNF12
• Host Species: Mouse
• Immunogen: RNF12 (NP_057204, 1 a.a. ∼ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Gene ID (Entrez): 51132
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ