Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001541

ring finger protein 138, Mouse, Clone: 3G2, Abnova™

Catalog No. 89001541 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-541 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-541 Supplier Abnova Corporation Supplier No. H00051444M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant RNF138.

The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Sequence: GAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTS

Specifications

Antigen ring finger protein 138
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3G2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RNF138.
Formulation ascites with no preservative
Gene RNF138
Gene Accession No. NM_016271
Gene Alias HSD-4/MGC8758/NARF/STRIN
Gene Symbols RNF138
Host Species Mouse
Immunogen RNF138 (NP_055369, 51 a.a. ∼ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 51444
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.