Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF146, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RNF146.

Manufacturer:  Abnova Corporation H00081847A01

Catalog No. 89-003-172


Add to cart

Description

Description

Sequence: MAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGR
Specifications

Specifications

RNF146
Unconjugated
50% glycerol
NM_030963
DKFZp434O1427|RP3-351K20.1|dJ351K20.1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant RNF146.
RNF146
Liquid
RNF146
RNF146 (NP_112225, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
RUO
Primary
81847
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit